PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo6G0070000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 270aa    MW: 30900.8 Da    PI: 5.811
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo6G0070000genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.4e-16855148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed +l+  v++lG ++W+ +a+  g++Rt+k+c++rw +yl
   Spipo6G0070000  8 KGPWTEQEDRQLASSVELLGDRRWDFVAKVSGLNRTGKSCRLRWVNYL 55
                     79********************************************97 PP

2Myb_DNA-binding57.62.9e-1861106148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rgr+T++E+ l++++++++G++ W++Iar+++ gRt++++k++w++++
   Spipo6G0070000  61 RGRMTPQEERLIIELHARWGNR-WSRIARRLP-GRTDNEIKNYWRTHM 106
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.926355IPR017930Myb domain
SuperFamilySSF466891.83E-287102IPR009057Homeodomain-like
SMARTSM007172.9E-14757IPR001005SANT/Myb domain
PfamPF002492.6E-15855IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-20962IPR009057Homeodomain-like
CDDcd001671.08E-91055No hitNo description
PROSITE profilePS5129426.12456110IPR017930Myb domain
SMARTSM007173.1E-1760108IPR001005SANT/Myb domain
PfamPF002492.0E-1661105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.6E-2463109IPR009057Homeodomain-like
CDDcd001671.31E-1163106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MVKEETRKGP WTEQEDRQLA SSVELLGDRR WDFVAKVSGL NRTGKSCRLR WVNYLDPCLK  60
RGRMTPQEER LIIELHARWG NRWSRIARRL PGRTDNEIKN YWRTHMRKKA QEGRTKAWSP  120
PQSSASSPSS LYLQSAPPTE APAVNPEPCG AGMEAWPREK EDDGEQEGCP MEQIWDEISG  180
LARFEEFSED EACNISCLPM SSPLWDYARD TPSWKIDEEF KMFLPFSAPV WSMEEDPANT  240
QTLPVHLHSS NAASSTCGRC GIIRELFPR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-2751101105MYB PROTO-ONCOGENE PROTEIN
1h88_C7e-27511055159MYB PROTO-ONCOGENE PROTEIN
1h89_C7e-27511055159MYB PROTO-ONCOGENE PROTEIN
1h8a_C3e-27511024128MYB TRANSFORMING PROTEIN
1mse_C2e-2781104105C-Myb DNA-Binding Domain
1msf_C2e-2781104105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00600PBMTransfer from AT5G59780Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008795619.13e-82PREDICTED: myb-related protein MYBAS1-like
SwissprotQ53NK68e-74MYBA1_ORYSJ; Myb-related protein MYBAS1
TrEMBLA0A061GXJ92e-76A0A061GXJ9_THECC; Myb domain protein 59 isoform 2
STRINGOB11G27690.16e-75(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63637169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.32e-66myb domain protein 59